Genemed Synthesis Inc.
Genemed Synthesis Inc.
Excellence by Design, Dedication, and Experience
Tuesday October 23, 2018
Sign In     My Cart    My Account    Corporate    Distributors    Customer Service    Toll Free (800) 344-5337
Browse By
New Products
Special Promotions
Request A Catalog
Request Quote
Bioactive Peptides
Recently Viewed Items
Join Mailing Lists



All 0-9 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
    showing 1 - 25 of 2160   next 25
Catalog# Product Description Product Type Product Data sheet Size Price
[-Ala8]-Neurokinin A (4-10) (Asp-Ser-Phe-Val--Ala-Leu-Met-NH2; MW: 781) Pure Peptide PDF 5 mg $95.00
[Nle10]-Neurokinin A (4-10) [Asp-Ser-Phe-Val-Gly-Leu-Nle-NH2; MW 748.88] Pure Peptide PDF 5 mg $95.00
[Trp7,-Ala8]-Neurokinin A (4-10) [Asp-Ser-Phe-Trp--Ala-Leu-Met- NH2; MW 868.03] Pure Peptide PDF 5 mg $95.00
[Tyr5,D-Trp6,8,9,Arg-NH210]-Neurokinin A (4-10) [Asp-Tyr-D-Trp-Val-D-Trp-D-Trp-Arg-NH2; MW 1109.3] Pure Peptide PDF 5 mg $145.00
Biotin-Neurokinin B (AA: Biotin-Asp-Met-His-Asp-Phe-Phe-Val-Gly-Leu-Met-NH2) (MW: 1326.53) Pure Peptide PDF 5 mg $95.00
[Pro7]-Neurokinin B [Asp-Met-His-Asp-Phe-Phe-Pro-Gly-Leu-Met- NH2; MW 1208.43] Pure Peptide PDF 5 mg $95.00
[D-Pro2,D-Trp6,8,Nle10]-Neurokinin B [Asp-D-Pro-His-Asp-Phe-D-Trp-Val-D-Trp-Leu-Nle-NH2; MW: 1326.53] Pure Peptide PDF 5 mg $145.00
Neuromedin S (human) (AA: Ile-Leu-Gln-Arg-Gly-Ser-Gly-Thr-Ala-Ala-Val-Asp-Phe-Thr-Lys-Lys-Asp-His-Thr-Ala-Thr-Trp-Gly-Arg-Pro-Phe-Phe-Leu-Phe-Arg-Pro-Arg-Asn-NH2) (MW: 1326.53) Pure Peptide PDF 1 mg $95.00
Biotin-Neuromedin S (human) (AA: Biotin-Ile-Leu-Gln-Arg-Gly-Ser-Gly-Thr-Ala-Ala-Val-Asp-Phe-Thr-Lys-Lys-Asp-His-Thr-Ala-Thr-Trp-Gly-Arg-Pro-Phe-Phe-Leu-Phe-Arg-Pro-Arg-Asn-NH2) (MW: 1326.53) Pure Peptide PDF 1 mg $145.00
Prepro-Neuromedin S (70-103) (human) (AA: Phe-Leu-Phe-His-Tyr-Ser-Arg-Thr-Gln-Glu-Ala-Thr-His-Pro-Val-Lys-Thr-Gly-Phe-Pro-Pro-Val-His-Pro-Leu-Met-His-Leu-Ala-Ala-Lys-Leu-Ala-Asn) (MW: 3857.5) Pure Peptide PDF 1 mg $95.00
Neuromedin S (rat) (AA: Leu-Pro-Arg-Leu-Leu-His-Thr-Asp-Ser-Arg-Met-Ala-Thr-Ile-Asp-Phe-Pro-Lys-Lys-Asp-Pro-Thr-Thr-Ser-Leu-Gly-Arg-Pro-Phe-Phe-Leu-Phe-Arg-Pro-Arg-Asn-NH2) (MW: 1326.53) Pure Peptide PDF 1 mg $145.00
Biotin-Neuromedin S (rat) (AA: Biotin-Leu-Pro-Arg-Leu-Leu-His-Thr-Asp-Ser-Arg-Met-Ala-Thr-Ile-Asp-Phe-Pro-Lys-Lys-Asp-Pro-Thr-Thr-Ser-Leu-Gly-Arg-Pro-Phe-Phe-Leu-Phe-Arg-Pro-Arg-Asn-NH2) (MW: 1326.53) Pure Peptide PDF 1 mg $145.00
Prepro-Neuromedin U (104-136) (human) (AA: Phe-Leu-Phe-His-Tyr-Ser-Lys-Thr-Gln-Lys-Leu-Gly-Lys-Ser-Asn-Val-Val-Ser-Ser-Val-Val-His-Pro-Leu-Leu-Gln-Leu-Val-Pro-His-Leu-His-Glu) (MW: 3783.47) Pure Peptide PDF 1 mg $95.00
[Leu116]-Prepro-Neuromedin U (104-136) (human) [Phe-Leu-Phe-His-Tyr-Ser-Lys-Thr-Gln-Lys-Leu-Gly-Leu-Ser-Asn-Val-Val-Ser-Ser-Val-Val-His-Pro-Leu-Leu-Gln-Leu-Val-Pro-His-Leu-His-Glu; MW: 3768.45] Pure Peptide PDF 1 mg $95.00
Adipokinetic Hormone (Apis mellifera ligustica, Bombyx mori, Heliothis zea, Manduca sexta) (AA: Glp-Leu-Thr-Phe-Thr-Ser-Ser-Trp-Gly-NH2) (MW: 921) Pure Peptide PDF 5 mg $95.00
Adrenomedullin (1-50), rat (YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2; Disulfide bridge:Cys14-Cys19 ) (MW: 5729.5) Pure Peptide PDF 1 mg $245.00
Adrenomedullin (11-50) (rat) [Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2; (Disulfide bridge:Cys4-Cys9 ) (MW: 4521.2)] Pure Peptide PDF 1 mg $245.00
Adrenomedullin (16-31) (human, pig) (AA: Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-NH2 (Disulfide bridge:Cys1-Cys6) (MW: 1865.21) Pure Peptide PDF 1 mg $145.00
Adrenomedullin (26-52) (human) (AA: Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2) (MW: 3119.49) Pure Peptide PDF 1 mg $95.00
Proadrenomedullin (45-92) (human) (AA: Glu-Leu-Arg-Met-Ser-Ser-Ser-Tyr-Pro-Thr-Gly-Leu-Ala-Asp-Val-Lys-Ala-Gly-Pro-Ala-Gln-Thr-Leu-Ile-Arg-Pro-Gln-Asp-Met-Lys-Gly-Ala-Ser-Arg-Ser-Pro-Glu-Asp-Ser-Ser-Pro-Asp-Ala-Ala-Arg-Ile-Arg-Val) (MW: 5114.76) Pure Peptide PDF 1 mg $195.00
Proadrenomedullin (1-20) (human) (AA:Ala-Arg-Leu-Asp-Val-Ala-Ser-Glu-Phe-Arg-Lys-Lys-Trp-Asn-Lys-Trp-Ala-Leu-Ser-Arg-NH2) (MW: 2460.87) Pure Peptide PDF 1 mg $95.00
Proadrenomedullin (12-20) (human) (AA: Lys-Trp-Asn-Lys-Trp-Ala-Leu-Ser-Arg-NH2) (MW: 1187.41) Pure Peptide PDF 5 mg $95.00
a-Neoendorphin (1-8) [Tyr-Gly-Gly-Phe-Leu-Arg-Lys-Tyr (MW: 1003.17)] Pure Peptide PDF 5 mg $95.00
Nesfatin-1 (human) [Val-Pro-Ile-Asp-Ile-Asp-Lys-Thr-Lys-Val-Gln-Asn-Ile-His-Pro-Val-Glu-Ser-Ala-Lys-Ile-Glu-Pro-Pro-Asp-Thr-Gly-Leu-Tyr-Tyr-Asp-Glu-Tyr-Leu-Lys-Gln-Val-Ile-Asp-Val-Leu-Glu-Thr-Asp-Lys-His-Phe-Arg-Glu-Lys-Leu-Gln-Lys-Ala-Asp-Ile-Glu-Glu-Ile Pure Peptide PDF 1 mg $395.00
Nesfatin-1 (mouse) [Val-Pro-Ile-Asp-Val-Asp-Lys-Thr-Lys-Val-His-Asn-Thr-Glu-Pro-Val-Glu-Asn-Ala-Arg-Ile-Glu-Pro-Pro-Asp-Thr-Gly-Leu-Tyr-Tyr-Asp-Glu-Tyr-Leu-Lys-Gln-Val-Ile-Glu-Val-Leu-Glu-Thr-Asp-Pro-His-Phe-Arg-Glu-Lys-Leu-Gln-Lys-Ala-Asp-Ile-Glu-Glu-Ile Pure Peptide PDF 1 mg $395.00
    showing 1 - 25 of 2160   next 25
Genemed Synthesis Inc.| 6203 Woodlake Center Bldg#2 | San Antonio, Texas 78244 USA
Toll Free: (800)-344-5337 | 210-745-5988 | Fax: 210-569-6374| 210-745-5992 | Web: | Contact GSI
Copyright ©2018.  All rights reserved.